PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID maker-scaffold00987-augustus-gene-0.34-mRNA-1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Fagaceae; Castanea
Family LBD
Protein Properties Length: 206aa    MW: 22513.5 Da    PI: 6.2258
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
maker-scaffold00987-augustus-gene-0.34-mRNA-1genomeTHGPView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260136.31.1e-42411401100
                                         DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvye 64 
                                                    +CaaCk+lrr+Ca++Cvlapyfp ++p kf ++h++FGasn++k+l++lpe++r da+ss+vye
  maker-scaffold00987-augustus-gene-0.34-mRNA-1  41 PCAACKILRRRCAEKCVLAPYFPPTEPTKFTIAHRVFGASNIIKFLQDLPESQRADAVSSMVYE 104
                                                    7*************************************************************** PP

                                         DUF260  65 AearardPvyGavgvilklqqqleqlkaelallkee 100
                                                    A ar+rdPvyG++g i +lq+q+++l+a+la++++e
  maker-scaffold00987-augustus-gene-0.34-mRNA-1 105 AGARIRDPVYGCAGAICQLQKQVNELQAQLAKAQAE 140
                                                    ********************************9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.31340141IPR004883Lateral organ boundaries, LOB
PfamPF031951.1E-4241138IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005739Cellular Componentmitochondrion
Sequence ? help Back to Top
Protein Sequence    Length: 206 aa     Download sequence    Send to blast
MECSDTNTNS TTSSTPFSHS PSSSSSPSPS PPRTPPIVIS PCAACKILRR RCAEKCVLAP  60
YFPPTEPTKF TIAHRVFGAS NIIKFLQDLP ESQRADAVSS MVYEAGARIR DPVYGCAGAI  120
CQLQKQVNEL QAQLAKAQAE LVNMQCQQAN LVALICMEMS QSPQATVQQS LESNFITSTP  180
SSYQNNPCFL NEDNNPCLLW DHPVWT
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003597159.12e-96lateral organ boundaries (LOB) domain protein
SwissprotQ9LQR02e-75LBD1_ARATH; LOB domain-containing protein 1
TrEMBLG7IKN32e-96G7IKN3_MEDTR; Lateral organ boundaries (LOB) domain protein
STRINGGLYMA13G40370.26e-94(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF130334106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07900.14e-63LOB domain-containing protein 1